PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0100000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 272aa    MW: 30311.9 Da    PI: 8.7367
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0100000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.8e-1660105147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
   Spipo0G0100000  60 RGHWRPAEDAKLRELVARYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 105
                      899*****************************.***********996 PP

2Myb_DNA-binding56.27.8e-18112155146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+++l+ a++++G++ W++Iar ++ gRt++ +k++w+ 
   Spipo0G0100000 112 RRAFSEEEEDRLLAAHRLYGNK-WALIARLFP-GRTDNAVKNHWHV 155
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.69555106IPR017930Myb domain
SMARTSM007173.9E-1459108IPR001005SANT/Myb domain
PfamPF002493.1E-1660105IPR001005SANT/Myb domain
SuperFamilySSF466892.51E-2860153IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-2661113IPR009057Homeodomain-like
CDDcd001672.73E-1363104No hitNo description
PROSITE profilePS5129426.977107161IPR017930Myb domain
SMARTSM007172.6E-15111159IPR001005SANT/Myb domain
PfamPF002493.2E-15112154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-20114160IPR009057Homeodomain-like
CDDcd001674.41E-12114154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MDQQPHGHQG WGLQDLKREG RFIDGVNSGG ISLQKDEEED EGESFVGMKD QDTQTKLCAR  60
GHWRPAEDAK LRELVARYGP QNWNLIAEKL EGRSGKSCRL RWFNQLDPRI NRRAFSEEEE  120
DRLLAAHRLY GNKWALIARL FPGRTDNAVK NHWHVIMARK HREQSSAYRR RKACLPAGTP  180
PQAAEMGANN NACSGMDGRG APPRNRFYRG TPVMMSLGPA DLLGGFSADP HHTAWPAAGG  240
IAYACEDARG HDERNNGPKL PFFDFLGVGA T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-33581605107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010921315.12e-88PREDICTED: transcription factor MYB82-like isoform X2
SwissprotQ9FDW11e-40MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0B0PES82e-78A0A0B0PES8_G
TrEMBLA0A0D2QZ012e-78A0A0D2QZ01_G
TrEMBLK9LVY66e-79K9LVY6_9ASPA; R2R3 MYB (Fragment)
TrEMBLM0T2A04e-79M0T2A0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P27750_0011e-78(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-75myb domain protein 105